Lineage for d4xk4c2 (4xk4 C:87-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727945Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)
  7. 2727946Species Escherichia coli [TaxId:562] [89137] (4 PDB entries)
  8. 2727959Domain d4xk4c2: 4xk4 C:87-212 [272767]
    Other proteins in same PDB: d4xk4a1, d4xk4b1, d4xk4c1, d4xk4d1
    automated match to d3loca2
    complexed with duc

Details for d4xk4c2

PDB Entry: 4xk4 (more details), 2.27 Å

PDB Description: e. coli transcriptional regulator rutr with dihydrouracil
PDB Compounds: (C:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4xk4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk4c2 a.121.1.1 (C:87-212) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

SCOPe Domain Coordinates for d4xk4c2:

Click to download the PDB-style file with coordinates for d4xk4c2.
(The format of our PDB-style files is described here.)

Timeline for d4xk4c2: