SCOPe 2.08: Domain d4xk4b2: 4xk4 B:87-212

Lineage for d4xk4b2 (4xk4 B:87-212)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)

7. Species Escherichia coli [TaxId:562] [89137] (4 PDB entries)

8. Domain d4xk4b2: 4xk4 B:87-212 [272764]
   Other proteins in same PDB: d4xk4a1, d4xk4b1, d4xk4c1, d4xk4d1
   automated match to d3loca2
   complexed with duc

Details for d4xk4b2

PDB Entry: 4xk4, 2.27 Å

PDB Description: e. coli transcriptional regulator rutr with dihydrouracil

PDB Compounds: (B:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4xk4b2:

Sequence; same for both SEQRES and ATOM records:

>d4xk4b2 a.121.1.1 (B:87-212) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

Timeline for d4xk4b2:

• d4xk4b2 first appeared in SCOPe 2.05
  
• d4xk4b2 appears in SCOPe 2.07