Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Hypothetical transcriptional regulator YcdC [89136] (1 species) |
Species Escherichia coli [TaxId:562] [89137] (4 PDB entries) |
Domain d4xk4b2: 4xk4 B:87-212 [272764] Other proteins in same PDB: d4xk4a1, d4xk4b1, d4xk4c1, d4xk4d1 automated match to d3loca2 complexed with duc |
PDB Entry: 4xk4 (more details), 2.27 Å
SCOPe Domain Sequences for d4xk4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk4b2 a.121.1.1 (B:87-212) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii egirpr
Timeline for d4xk4b2: