Lineage for d4xk4d1 (4xk4 D:17-86)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692271Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
  7. 2692272Species Escherichia coli [TaxId:562] [88974] (4 PDB entries)
  8. 2692286Domain d4xk4d1: 4xk4 D:17-86 [272763]
    Other proteins in same PDB: d4xk4a2, d4xk4b2, d4xk4c2, d4xk4d2
    automated match to d3loca1
    complexed with duc

Details for d4xk4d1

PDB Entry: 4xk4 (more details), 2.27 Å

PDB Description: e. coli transcriptional regulator rutr with dihydrouracil
PDB Compounds: (D:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4xk4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk4d1 a.4.1.9 (D:17-86) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
wlaplkafre

SCOPe Domain Coordinates for d4xk4d1:

Click to download the PDB-style file with coordinates for d4xk4d1.
(The format of our PDB-style files is described here.)

Timeline for d4xk4d1: