SCOPe 2.06: Domain d4xk4b1: 4xk4 B:17-86

Lineage for d4xk4b1 (4xk4 B:17-86)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
Species Escherichia coli [TaxId:562] [88974] (4 PDB entries)
Domain d4xk4b1: 4xk4 B:17-86 [272762]
Other proteins in same PDB: d4xk4a2, d4xk4b2, d4xk4c2, d4xk4d2
automated match to d3loca1
complexed with duc

Details for d4xk4b1

PDB Entry: 4xk4 (more details), 2.27 Å

PDB Description: e. coli transcriptional regulator rutr with dihydrouracil

PDB Compounds: (B:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4xk4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk4b1 a.4.1.9 (B:17-86) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
wlaplkafre

SCOPe Domain Coordinates for d4xk4b1:

Click to download the PDB-style file with coordinates for d4xk4b1.
(The format of our PDB-style files is described here.)

Timeline for d4xk4b1: