Lineage for d1vweb_ (1vwe B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1800855Protein Streptavidin [50878] (1 species)
  7. 1800856Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)
  8. 1800947Domain d1vweb_: 1vwe B: [27275]

Details for d1vweb_

PDB Entry: 1vwe (more details), 1.5 Å

PDB Description: streptavidin-cyclo-ac-[chpqfc]-nh2, ph 3.6
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1vweb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vweb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOPe Domain Coordinates for d1vweb_:

Click to download the PDB-style file with coordinates for d1vweb_.
(The format of our PDB-style files is described here.)

Timeline for d1vweb_: