Lineage for d1vweb_ (1vwe B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62326Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 62327Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 62328Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 62343Protein Streptavidin [50878] (1 species)
  7. 62344Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)
  8. 62390Domain d1vweb_: 1vwe B: [27275]

Details for d1vweb_

PDB Entry: 1vwe (more details), 1.5 Å

PDB Description: streptavidin-cyclo-ac-[chpqfc]-nh2, ph 3.6

SCOP Domain Sequences for d1vweb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vweb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d1vweb_:

Click to download the PDB-style file with coordinates for d1vweb_.
(The format of our PDB-style files is described here.)

Timeline for d1vweb_: