Lineage for d4wmfb_ (4wmf B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390468Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (8 PDB entries)
  8. 2390474Domain d4wmfb_: 4wmf B: [272747]
    automated match to d2ynaa_
    complexed with peg, pg4

Details for d4wmfb_

PDB Entry: 4wmf (more details), 1.97 Å

PDB Description: crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup p212121
PDB Compounds: (B:) MERS-CoV 3CL protease

SCOPe Domain Sequences for d4wmfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wmfb_ b.47.1.0 (B:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgsagsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi
mgv

SCOPe Domain Coordinates for d4wmfb_:

Click to download the PDB-style file with coordinates for d4wmfb_.
(The format of our PDB-style files is described here.)

Timeline for d4wmfb_: