Lineage for d4wmfa_ (4wmf A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058301Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (5 PDB entries)
  8. 2058306Domain d4wmfa_: 4wmf A: [272746]
    automated match to d2ynaa_
    complexed with peg, pg4

Details for d4wmfa_

PDB Entry: 4wmf (more details), 1.97 Å

PDB Description: crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup p212121
PDB Compounds: (A:) MERS-CoV 3CL protease

SCOPe Domain Sequences for d4wmfa_:

Sequence, based on SEQRES records: (download)

>d4wmfa_ b.47.1.0 (A:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgsagsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi
mgvvm

Sequence, based on observed residues (ATOM records): (download)

>d4wmfa_ b.47.1.0 (A:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallism
tnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlacy
ngrptgtftvvmrpnytikgsflcgsagsvgytkegsvinfcymhqmelangthtgsafd
gtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalanq
ftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqim
gvvm

SCOPe Domain Coordinates for d4wmfa_:

Click to download the PDB-style file with coordinates for d4wmfa_.
(The format of our PDB-style files is described here.)

Timeline for d4wmfa_: