Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (33 species) not a true protein |
Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (14 PDB entries) |
Domain d4wmda_: 4wmd A: [272745] automated match to d2ynaa_ complexed with 1pe, peg, pg4, pge |
PDB Entry: 4wmd (more details), 2.59 Å
SCOPe Domain Sequences for d4wmda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wmda_ b.47.1.0 (A:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]} sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac yngrptgtftvvmrpnytikgsflcgsagsvgytkegsvinfcymhqmelangthtgsaf dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi m
Timeline for d4wmda_: