Lineage for d4wmdb_ (4wmd B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795550Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1795551Protein automated matches [190438] (20 species)
    not a true protein
  7. 1795684Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (5 PDB entries)
  8. 1795697Domain d4wmdb_: 4wmd B: [272741]
    automated match to d2ynaa_
    complexed with 1pe, peg, pg4, pge

Details for d4wmdb_

PDB Entry: 4wmd (more details), 2.59 Å

PDB Description: crystal structure of catalytically inactive mers-cov 3cl protease (c148a) in spacegroup c2221
PDB Compounds: (B:) ORF1a

SCOPe Domain Sequences for d4wmdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wmdb_ b.47.1.0 (B:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgsagsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi
mgvv

SCOPe Domain Coordinates for d4wmdb_:

Click to download the PDB-style file with coordinates for d4wmdb_.
(The format of our PDB-style files is described here.)

Timeline for d4wmdb_: