SCOPe 2.05: Domain d1vwhb_: 1vwh B:

Lineage for d1vwhb_ (1vwh B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)

8. Domain d1vwhb_: 1vwh B: [27274]

Details for d1vwhb_

PDB Entry: 1vwh, 1.48 Å

PDB Description: streptavidin complexed with the head-to-tail disulfide-bonded peptide dimer of cyclo-ac-[chpqgppc]-nh2, ph 3.5

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1vwhb_:

Sequence; same for both SEQRES and ATOM records:

>d1vwhb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1vwhb_:

• d1vwhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1vwhb_ appears in SCOPe 2.04
  
• d1vwhb_ appears in SCOPe 2.06
  
• d1vwhb_ appears in the current release, SCOPe 2.08