Lineage for d4wipc_ (4wip C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893753Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1893754Protein automated matches [190233] (11 species)
    not a true protein
  7. 1893780Species Human (Homo sapiens) [TaxId:9606] [187090] (45 PDB entries)
  8. 1893832Domain d4wipc_: 4wip C: [272739]
    automated match to d1wspb_
    complexed with 1pe

Details for d4wipc_

PDB Entry: 4wip (more details), 2.69 Å

PDB Description: dix domain of human dvl2
PDB Compounds: (C:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d4wipc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wipc_ d.15.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
getkviyhldeeetpdlvkipvpaeritlgdfksvlqrpagakyffksmdqdfgvvkeei
sddnarlpcfngrvvswlvss

SCOPe Domain Coordinates for d4wipc_:

Click to download the PDB-style file with coordinates for d4wipc_.
(The format of our PDB-style files is described here.)

Timeline for d4wipc_: