SCOPe 2.06: Domain d4wipb_: 4wip B:

Lineage for d4wipb_ (4wip B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d4wipb_: 4wip B: [272738]
   automated match to d1wspb_
   complexed with 1pe

Details for d4wipb_

PDB Entry: 4wip, 2.69 Å

PDB Description: dix domain of human dvl2

PDB Compounds: (B:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d4wipb_:

Sequence; same for both SEQRES and ATOM records:

>d4wipb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgetkviyhldeeetpdlvkipvpaeritlgdfksvlqrpagakyffksmdqdfgvvkee
isddnarlpcfngrvvswlvs

Timeline for d4wipb_:

• d4wipb_ first appeared in SCOPe 2.05
  
• d4wipb_ appears in SCOPe 2.07
  
• d4wipb_ appears in the current release, SCOPe 2.08