SCOPe 2.07: Domain d4wiqa2: 4wiq A:179-303

Lineage for d4wiqa2 (4wiq A:179-303)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily)
   beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861)

4. Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family)

5. Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins)

6. Protein automated matches [272735] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [272736] (3 PDB entries)

8. Domain d4wiqa2: 4wiq A:179-303 [272737]
   Other proteins in same PDB: d4wiqa1
   automated match to d1u2ca2
   complexed with cl, edo; mutant

Details for d4wiqa2

PDB Entry: 4wiq, 1.59 Å

PDB Description: the structure of murine alpha-dystroglycan t190m mutant n-terminal domain.

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d4wiqa2:

Sequence; same for both SEQRES and ATOM records:

>d4wiqa2 d.272.1.1 (A:179-303) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
acaadepvtvlmvildadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsa
fmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhia
nkkpt

Timeline for d4wiqa2:

• d4wiqa2 first appeared in SCOPe 2.05
  
• d4wiqa2 appears in SCOPe 2.06
  
• d4wiqa2 appears in the current release, SCOPe 2.08