Lineage for d4wiqa1 (4wiq A:58-163)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373405Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2373500Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (2 proteins)
  6. 2373504Protein automated matches [272731] (1 species)
    not a true protein
  7. 2373505Species Mouse (Mus musculus) [TaxId:10090] [272732] (3 PDB entries)
  8. 2373506Domain d4wiqa1: 4wiq A:58-163 [272734]
    Other proteins in same PDB: d4wiqa2
    automated match to d1u2ca1
    complexed with cl, edo; mutant

Details for d4wiqa1

PDB Entry: 4wiq (more details), 1.59 Å

PDB Description: the structure of murine alpha-dystroglycan t190m mutant n-terminal domain.
PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d4wiqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wiqa1 b.1.6.2 (A:58-163) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg
lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnepq

SCOPe Domain Coordinates for d4wiqa1:

Click to download the PDB-style file with coordinates for d4wiqa1.
(The format of our PDB-style files is described here.)

Timeline for d4wiqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wiqa2