Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
Domain d4wipa_: 4wip A: [272733] automated match to d1wspb_ complexed with 1pe |
PDB Entry: 4wip (more details), 2.69 Å
SCOPe Domain Sequences for d4wipa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wipa_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgetkviyhldeeetpdlvkipvpaeritlgdfksvlqrpagakyffksmdqdfgvvkee isddnarlpcfngrvvswlvs
Timeline for d4wipa_: