Lineage for d4u5la_ (4u5l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006377Protein Importin alpha [48376] (1 species)
  7. 2006378Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2006403Domain d4u5la_: 4u5l A: [272716]
    automated match to d4e4va_
    complexed with 3d6

Details for d4u5la_

PDB Entry: 4u5l (more details), 2.53 Å

PDB Description: importin-alpha minor nls site inhibitor
PDB Compounds: (A:) Importin subunit alpha-1

SCOPe Domain Sequences for d4u5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u5la_ a.118.1.1 (A:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
iekyfs

SCOPe Domain Coordinates for d4u5la_:

Click to download the PDB-style file with coordinates for d4u5la_.
(The format of our PDB-style files is described here.)

Timeline for d4u5la_: