Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [272710] (2 PDB entries) |
Domain d4u00a_: 4u00 A: [272715] automated match to d2oukb_ complexed with adp, cl, mg |
PDB Entry: 4u00 (more details), 2.1 Å
SCOPe Domain Sequences for d4u00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u00a_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} piirirnlhkwfgplhvlkgihlevapgeklviigpsgsgkstlirtinrledfqegevv vdglsvkddralreirrevgmvfqqfnlfphmtvlenvtlapmrvrrwprekaekkalel lervgildqarkypaqlsggqqqrvaiaralamepkimlfdeptsaldpemvgevldvmr dlaqggmtmvvvthemgfarevadrvvfmdggqiveegrpeeiftrpkeertrsflqrvl h
Timeline for d4u00a_: