Lineage for d4u54a_ (4u54 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006978Species Mouse (Mus musculus) [TaxId:10090] [272712] (5 PDB entries)
  8. 2006980Domain d4u54a_: 4u54 A: [272713]
    automated match to d3feyc_
    complexed with 3c5

Details for d4u54a_

PDB Entry: 4u54 (more details), 2.41 Å

PDB Description: importin-alpha minor nls site inhibitor
PDB Compounds: (A:) Importin subunit alpha-1

SCOPe Domain Sequences for d4u54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u54a_ a.118.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdc
spiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdg
safrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqil
ptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpa
lraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqv
vnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakd
tkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnlie
kyfsv

SCOPe Domain Coordinates for d4u54a_:

Click to download the PDB-style file with coordinates for d4u54a_.
(The format of our PDB-style files is described here.)

Timeline for d4u54a_: