SCOPe 2.08: Domain d4tmfb1: 4tmf B:50-291

Lineage for d4tmfb1 (4tmf B:50-291)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (46 PDB entries)
   Uniprot P28907 45-291

8. Domain d4tmfb1: 4tmf B:50-291 [272709]
   Other proteins in same PDB: d4tmfa2, d4tmfb2
   automated match to d4f45a_
   complexed with js2

Details for d4tmfb1

PDB Entry: 4tmf, 2.05 Å

PDB Description: crystal structure of human cd38 in complex with hydrolysed compound jms713

PDB Compounds: (B:) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

SCOPe Domain Sequences for d4tmfb1:

Sequence, based on SEQRES records:

>d4tmfb1 c.23.14.3 (B:50-291) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
wsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqpl
mklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtskin
yqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevhn
lqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkflqcvk
np

Sequence, based on observed residues (ATOM records):

>d4tmfb1 c.23.14.3 (B:50-291) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
wsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqpl
mklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtskin
yqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevhn
lqpekvqtleawvihrdlcqdptikelesiiskrniqfsckniyrpdkflqcvknp

Timeline for d4tmfb1:

• d4tmfb1 first appeared in SCOPe 2.05, called d4tmfb_
  
• d4tmfb1 appears in SCOPe 2.07