Lineage for d4rmpb1 (4rmp B:1-155)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302507Protein automated matches [190531] (20 species)
    not a true protein
  7. 2302600Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries)
  8. 2302698Domain d4rmpb1: 4rmp B:1-155 [272705]
    Other proteins in same PDB: d4rmpa2, d4rmpb2
    automated match to d3dbjb_
    complexed with cyc

Details for d4rmpb1

PDB Entry: 4rmp (more details), 2.51 Å

PDB Description: crystal structure of allophycocyanin from marine cyanobacterium phormidium sp. a09dm
PDB Compounds: (B:) allophycocyanin

SCOPe Domain Sequences for d4rmpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rmpb1 a.1.1.3 (B:1-155) automated matches {Phormidium rubidum [TaxId: 865859]}
mqdaitavinssdvqgkyldgsameklkayfqtgelrvraattisanaaeivkdavaksl
lysditrpggnmyttrryaacirdldyylrystyamlagdpsildervlnglketynslg
vpvgatvqaiqamkevtatlvgadagkemgvyfdy

SCOPe Domain Coordinates for d4rmpb1:

Click to download the PDB-style file with coordinates for d4rmpb1.
(The format of our PDB-style files is described here.)

Timeline for d4rmpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rmpb2