Lineage for d4rmpb_ (4rmp B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718294Protein automated matches [190531] (16 species)
    not a true protein
  7. 1718368Species Phormidium rubidum [TaxId:865859] [272704] (1 PDB entry)
  8. 1718370Domain d4rmpb_: 4rmp B: [272705]
    automated match to d3dbjb_
    complexed with cyc

Details for d4rmpb_

PDB Entry: 4rmp (more details), 2.51 Å

PDB Description: crystal structure of allophycocyanin from marine cyanobacterium phormidium sp. a09dm
PDB Compounds: (B:) allophycocyanin

SCOPe Domain Sequences for d4rmpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rmpb_ a.1.1.3 (B:) automated matches {Phormidium rubidum [TaxId: 865859]}
mqdaitavinssdvqgkyldgsameklkayfqtgelrvraattisanaaeivkdavaksl
lysditrpggnmyttrryaacirdldyylrystyamlagdpsildervlnglketynslg
vpvgatvqaiqamkevtatlvgadagkemgvyfdyicsgls

SCOPe Domain Coordinates for d4rmpb_:

Click to download the PDB-style file with coordinates for d4rmpb_.
(The format of our PDB-style files is described here.)

Timeline for d4rmpb_: