SCOPe 2.06: Domain d4ra2a2: 4ra2 A:297-368

Lineage for d4ra2a2 (4ra2 A:297-368)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (2 families)
   automatically mapped to Pfam PF07830

5. Family a.159.1.0: automated matches [232204] (1 protein)
   not a true family

6. Protein automated matches [232205] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232206] (8 PDB entries)

8. Domain d4ra2a2: 4ra2 A:297-368 [272703]
   Other proteins in same PDB: d4ra2a1
   automated match to d1a6qa1
   complexed with mn, po4

Details for d4ra2a2

PDB Entry: 4ra2, 1.94 Å

PDB Description: pp2ca

PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d4ra2a2:

Sequence, based on SEQRES records:

>d4ra2a2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records):

>d4ra2a2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnviea
vynrlnpy

Timeline for d4ra2a2:

• d4ra2a2 first appeared in SCOPe 2.05
  
• d4ra2a2 appears in SCOPe 2.07
  
• d4ra2a2 appears in the current release, SCOPe 2.08