Lineage for d4r0xa_ (4r0x A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1899921Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1900153Protein automated matches [191209] (3 species)
    not a true protein
  7. 1900154Species Human (Homo sapiens) [TaxId:9606] [189839] (38 PDB entries)
  8. 1900176Domain d4r0xa_: 4r0x A: [272701]
    automated match to d3o5ea_

Details for d4r0xa_

PDB Entry: 4r0x (more details), 1.2 Å

PDB Description: allosteric coupling of conformational transitions in the fk1 domain of fkbp51 near the site of steroid receptor interaction
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4r0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r0xa_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrnepfv
fslgkgqvikawdigvatmkkgeichllckpeyaygsagslpgipsnatlffeielldfk
ge

SCOPe Domain Coordinates for d4r0xa_:

Click to download the PDB-style file with coordinates for d4r0xa_.
(The format of our PDB-style files is described here.)

Timeline for d4r0xa_: