Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries) |
Domain d4qdbd_: 4qdb D: [272697] automated match to d2b6ed_ mutant |
PDB Entry: 4qdb (more details), 2.02 Å
SCOPe Domain Sequences for d4qdbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qdbd_ d.38.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthapfgllhggasvv laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls gddgkpsciarltmavvpl
Timeline for d4qdbd_: