![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (32 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [272670] (5 PDB entries) |
![]() | Domain d4qdbb_: 4qdb B: [272696] automated match to d2b6ed_ mutant |
PDB Entry: 4qdb (more details), 2.02 Å
SCOPe Domain Sequences for d4qdbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qdbb_ d.38.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthapfgllhggasvv laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls gddgkpsciarltmavvpl
Timeline for d4qdbb_: