SCOPe 2.05: Domain d4qd9f_: 4qd9 F:

Lineage for d4qd9f_ (4qd9 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (32 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [272670] (5 PDB entries)

8. Domain d4qd9f_: 4qd9 F: [272676]
   automated match to d2b6ef_
   complexed with 31b

Details for d4qd9f_

PDB Entry: 4qd9, 1.77 Å

PDB Description: crystal structure of thioesterase pa1618 from pseudomonas aeruginosa in complex with benzoyl-do-coa

PDB Compounds: (F:) Thioesterase PA1618

SCOPe Domain Sequences for d4qd9f_:

Sequence; same for both SEQRES and ATOM records:

>d4qd9f_ d.38.1.0 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthqpfgllhggasvv
laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls
gddgkpsciarltmavvpl

Timeline for d4qd9f_:

• d4qd9f_ is new in SCOPe 2.05-stable
  
• d4qd9f_ appears in SCOPe 2.06
  
• d4qd9f_ appears in the current release, SCOPe 2.08