Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (32 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [272670] (5 PDB entries) |
Domain d4qd9b_: 4qd9 B: [272672] automated match to d2b6ef_ complexed with 31b |
PDB Entry: 4qd9 (more details), 1.77 Å
SCOPe Domain Sequences for d4qd9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qd9b_ d.38.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthqpfgllhggasvv laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls gddgkpsciarltmavvpl
Timeline for d4qd9b_: