![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins) |
![]() | Protein automated matches [254454] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254968] (5 PDB entries) |
![]() | Domain d4qded2: 4qde D:146-337 [272669] Other proteins in same PDB: d4qdea1, d4qdeb1, d4qdec1, d4qded1 automated match to d1st0a1 protein/RNA complex; complexed with 30s, po4 |
PDB Entry: 4qde (more details), 2.9 Å
SCOPe Domain Sequences for d4qded2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qded2 d.13.1.3 (D:146-337) automated matches {Human (Homo sapiens) [TaxId: 9606]} qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd pllkllqeaqqs
Timeline for d4qded2: