Lineage for d4qded2 (4qde D:146-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929951Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)
  6. 2929967Protein automated matches [254454] (1 species)
    not a true protein
  7. 2929968Species Human (Homo sapiens) [TaxId:9606] [254968] (5 PDB entries)
  8. 2929984Domain d4qded2: 4qde D:146-337 [272669]
    Other proteins in same PDB: d4qdea1, d4qdeb1, d4qdec1, d4qded1
    automated match to d1st0a1
    protein/RNA complex; complexed with 30s, po4

Details for d4qded2

PDB Entry: 4qde (more details), 2.9 Å

PDB Description: dcps in complex with covalent inhibitor
PDB Compounds: (D:) m7GpppX diphosphatase

SCOPe Domain Sequences for d4qded2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qded2 d.13.1.3 (D:146-337) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqqs

SCOPe Domain Coordinates for d4qded2:

Click to download the PDB-style file with coordinates for d4qded2.
(The format of our PDB-style files is described here.)

Timeline for d4qded2: