SCOPe 2.05: Domain d4qdec2: 4qde C:146-336

Lineage for d4qdec2 (4qde C:146-336)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)

6. Protein automated matches [254454] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254968] (4 PDB entries)

8. Domain d4qdec2: 4qde C:146-336 [272666]
   Other proteins in same PDB: d4qdea1, d4qdeb1, d4qdec1, d4qded1
   automated match to d1st0a1
   protein/RNA complex; complexed with 30s, po4

Details for d4qdec2

PDB Entry: 4qde, 2.9 Å

PDB Description: dcps in complex with covalent inhibitor

PDB Compounds: (C:) m7GpppX diphosphatase

SCOPe Domain Sequences for d4qdec2:

Sequence; same for both SEQRES and ATOM records:

>d4qdec2 d.13.1.3 (C:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

Timeline for d4qdec2:

• d4qdec2 is new in SCOPe 2.05-stable
  
• d4qdec2 appears in SCOPe 2.06
  
• d4qdec2 appears in the current release, SCOPe 2.08