Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (5 families) |
Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins) |
Protein automated matches [254454] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254968] (4 PDB entries) |
Domain d4qdec2: 4qde C:146-336 [272666] Other proteins in same PDB: d4qdea1, d4qdeb1, d4qdec1, d4qded1 automated match to d1st0a1 protein/RNA complex; complexed with 30s, po4 |
PDB Entry: 4qde (more details), 2.9 Å
SCOPe Domain Sequences for d4qdec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qdec2 d.13.1.3 (C:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]} qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd pllkllqeaqq
Timeline for d4qdec2: