| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily) beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a |
Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) ![]() forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4] automatically mapped to Pfam PF05652 |
| Family d.246.1.0: automated matches [254206] (1 protein) not a true family |
| Protein automated matches [254453] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [254967] (5 PDB entries) |
| Domain d4qdec1: 4qde C:39-145 [272663] Other proteins in same PDB: d4qdea2, d4qdeb2, d4qdec2, d4qded2 automated match to d1st0a2 protein/RNA complex; complexed with 30s, po4 |
PDB Entry: 4qde (more details), 2.9 Å
SCOPe Domain Sequences for d4qdec1:
Sequence, based on SEQRES records: (download)
>d4qdec1 d.246.1.0 (C:39-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqll
tgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr
>d4qdec1 d.246.1.0 (C:39-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvrlpfsgfrlqkvlresardkiiflhgkgedavvilektpfqveqvaqlltgspelqlq
fsndiystyhlfpprqlndvkttvvypatekhlqkylr
Timeline for d4qdec1: