Lineage for d4qdec1 (4qde C:39-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008663Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 3008664Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 3008681Family d.246.1.0: automated matches [254206] (1 protein)
    not a true family
  6. 3008682Protein automated matches [254453] (1 species)
    not a true protein
  7. 3008683Species Human (Homo sapiens) [TaxId:9606] [254967] (5 PDB entries)
  8. 3008698Domain d4qdec1: 4qde C:39-145 [272663]
    Other proteins in same PDB: d4qdea2, d4qdeb2, d4qdec2, d4qded2
    automated match to d1st0a2
    protein/RNA complex; complexed with 30s, po4

Details for d4qdec1

PDB Entry: 4qde (more details), 2.9 Å

PDB Description: dcps in complex with covalent inhibitor
PDB Compounds: (C:) m7GpppX diphosphatase

SCOPe Domain Sequences for d4qdec1:

Sequence, based on SEQRES records: (download)

>d4qdec1 d.246.1.0 (C:39-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqll
tgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

Sequence, based on observed residues (ATOM records): (download)

>d4qdec1 d.246.1.0 (C:39-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvrlpfsgfrlqkvlresardkiiflhgkgedavvilektpfqveqvaqlltgspelqlq
fsndiystyhlfpprqlndvkttvvypatekhlqkylr

SCOPe Domain Coordinates for d4qdec1:

Click to download the PDB-style file with coordinates for d4qdec1.
(The format of our PDB-style files is described here.)

Timeline for d4qdec1: