Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Entamoeba histolytica [TaxId:885315] [272653] (1 PDB entry) |
Domain d4cw9a_: 4cw9 A: [272656] Other proteins in same PDB: d4cw9b2 automated match to d2oe3b_ mutant |
PDB Entry: 4cw9 (more details), 1.84 Å
SCOPe Domain Sequences for d4cw9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cw9a_ c.47.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 885315]} avlhinaldqltallstekvividffatwcgpsrsispyfeelagqynnikfvkvdvdqa eeicvnykvrsmptfvlvkdgieqkrfsgadrnalkqmveta
Timeline for d4cw9a_: