Lineage for d4cw9a_ (4cw9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879449Species Entamoeba histolytica [TaxId:885315] [272653] (1 PDB entry)
  8. 2879450Domain d4cw9a_: 4cw9 A: [272656]
    Other proteins in same PDB: d4cw9b2
    automated match to d2oe3b_
    mutant

Details for d4cw9a_

PDB Entry: 4cw9 (more details), 1.84 Å

PDB Description: entamoeba histolytica thiredoxin c34s mutant
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d4cw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cw9a_ c.47.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 885315]}
avlhinaldqltallstekvividffatwcgpsrsispyfeelagqynnikfvkvdvdqa
eeicvnykvrsmptfvlvkdgieqkrfsgadrnalkqmveta

SCOPe Domain Coordinates for d4cw9a_:

Click to download the PDB-style file with coordinates for d4cw9a_.
(The format of our PDB-style files is described here.)

Timeline for d4cw9a_: