Lineage for d4cxsa_ (4cxs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138572Family c.76.1.2: Arylsulfatase [53653] (4 protein domains)
    includes additional C-terminal alpha+beta (sub)domain
  6. 2138591Protein automated matches [271610] (1 species)
    not a true protein
  7. 2138592Species Pseudomonas aeruginosa [TaxId:287] [271614] (6 PDB entries)
  8. 2138601Domain d4cxsa_: 4cxs A: [272655]
    automated match to d1hdha_
    complexed with ca, so4, sv7; mutant

Details for d4cxsa_

PDB Entry: 4cxs (more details), 2.3 Å

PDB Description: g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with phenylphosphonic acid
PDB Compounds: (A:) arylsulfatase

SCOPe Domain Sequences for d4cxsa_:

Sequence, based on SEQRES records: (download)

>d4cxsa_ c.76.1.2 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
krpnflvivaddlgfsdigtfggeiatpnldalaiaglrltdfhtasaxsptrsmlltgt
dhhiagigtmaealtpelegkpgyeghlnervvalpellreagyqtlmagkwhlglkpeq
tphargfersfallpgaanhygfeppydestprilkgtpalyvederyldtlpegfyssd
afgdkllqylkerdqsrpffaylpfsaphwplqapreivekyrgrydagpealrqerlar
lkelglveadveahpvlaltrewealedeeraksaramevyaamvermdwnigrvvdylr
rqgeldntfvlfmsdngaegalleafpkfgpdlldfldrhydnslenigransyvwygpr
waqaatapsrlykafttqggirvpalvryprlsrqgaishafatvmdvtptlldlagvrh
pgkrwrgreiaeprgrswlgwlsgeteaahdentvtgwglfgmrairqgdwkavylpapv
gpatwqlydlardpgeihdladsqpgklaeliehwkryvsdtgvv

Sequence, based on observed residues (ATOM records): (download)

>d4cxsa_ c.76.1.2 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
krpnflvivaddlgfsdigtfggeiatpnldalaiaglrltdfhtasaxsptrsmlltgt
dhhiagigtmaeallegkpgyeghlnervvalpellreagyqtlmagkwhlglkpeqtph
argfersfallpgaanhygfeppydestprilkgtpalyvederyldtlpegfyssdafg
dkllqylkerdqsrpffaylpfsaphwplqapreivekyrgrydagpealrqerlarlke
lglveadveahpvlaltrewealedeeraksaramevyaamvermdwnigrvvdylrrqg
eldntfvlfmsdngaegalleafpkfgpdlldfldrhydnslenigransyvwygprwaq
aatapsrlykafttqggirvpalvryprlsrqgaishafatvmdvtptlldlagvrhpgk
rwrgreiaeprgrswlgwlsgeteaahdentvtgwglfgmrairqgdwkavylpapvgpa
twqlydlardpgeihdladsqpgklaeliehwkryvsdtgvv

SCOPe Domain Coordinates for d4cxsa_:

Click to download the PDB-style file with coordinates for d4cxsa_.
(The format of our PDB-style files is described here.)

Timeline for d4cxsa_: