SCOPe 2.07: Domain d1vwld_: 1vwl D:

Lineage for d1vwld_ (1vwl D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d1vwld_: 1vwl D: [27265]
   complexed with lea

Details for d1vwld_

PDB Entry: 1vwl, 1.45 Å

PDB Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 3.5, i222 complex

PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1vwld_:

Sequence; same for both SEQRES and ATOM records:

>d1vwld_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1vwld_:

• d1vwld_ first appeared (with stable ids) in SCOP 1.55
  
• d1vwld_ appears in SCOPe 2.06
  
• d1vwld_ appears in the current release, SCOPe 2.08