![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
![]() | Protein automated matches [271870] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [271874] (57 PDB entries) |
![]() | Domain d5am1a2: 5am1 A:228-547 [272649] Other proteins in same PDB: d5am1a1 automated match to d3i28a2 complexed with dms, i5t, so4 |
PDB Entry: 5am1 (more details), 2.15 Å
SCOPe Domain Sequences for d5am1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5am1a2 c.69.1.11 (A:228-547) automated matches {Human (Homo sapiens) [TaxId: 9606]} lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq mdkptevnqilikwldsdar
Timeline for d5am1a2: