![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.2: YihX-like [56789] (3 proteins) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF13419 |
![]() | Protein automated matches [272539] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [272542] (54 PDB entries) |
![]() | Domain d5am3a1: 5am3 A:2-227 [272642] Other proteins in same PDB: d5am3a2 automated match to d1zd3a1 complexed with aub, gol, peg, so4 |
PDB Entry: 5am3 (more details), 2.2 Å
SCOPe Domain Sequences for d5am3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5am3a1 c.108.1.2 (A:2-227) automated matches {Human (Homo sapiens) [TaxId: 9606]} tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap
Timeline for d5am3a1: