Lineage for d1vwlb_ (1vwl B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325094Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1325117Protein Streptavidin [50878] (1 species)
  7. 1325118Species Streptomyces avidinii [TaxId:1895] [50879] (122 PDB entries)
  8. 1325184Domain d1vwlb_: 1vwl B: [27264]
    complexed with lea

Details for d1vwlb_

PDB Entry: 1vwl (more details), 1.45 Å

PDB Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 3.5, i222 complex
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1vwlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwlb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d1vwlb_:

Click to download the PDB-style file with coordinates for d1vwlb_.
(The format of our PDB-style files is described here.)

Timeline for d1vwlb_: