Lineage for d5alea2 (5ale A:228-547)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508005Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2508075Protein automated matches [271870] (2 species)
    not a true protein
  7. 2508081Species Human (Homo sapiens) [TaxId:9606] [271874] (64 PDB entries)
  8. 2508099Domain d5alea2: 5ale A:228-547 [272637]
    Other proteins in same PDB: d5alea1
    automated match to d3i28a2
    complexed with gol, onr, so4

Details for d5alea2

PDB Entry: 5ale (more details), 1.95 Å

PDB Description: ligand complex structure of soluble epoxide hydrolase
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d5alea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5alea2 c.69.1.11 (A:228-547) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdar

SCOPe Domain Coordinates for d5alea2:

Click to download the PDB-style file with coordinates for d5alea2.
(The format of our PDB-style files is described here.)

Timeline for d5alea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5alea1