SCOPe 2.08: Domain d5alea1: 5ale A:2-227

Lineage for d5alea1 (5ale A:2-227)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: YihX-like [56789] (3 proteins)
   the insertion subdomain is a 4-helical bundle
   automatically mapped to Pfam PF13419

6. Protein automated matches [272539] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [272542] (54 PDB entries)

8. Domain d5alea1: 5ale A:2-227 [272636]
   Other proteins in same PDB: d5alea2
   automated match to d1zd3a1
   complexed with gol, onr, so4

Details for d5alea1

PDB Entry: 5ale, 1.95 Å

PDB Description: ligand complex structure of soluble epoxide hydrolase

PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d5alea1:

Sequence; same for both SEQRES and ATOM records:

>d5alea1 c.108.1.2 (A:2-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

Timeline for d5alea1:

• d5alea1 first appeared in SCOPe 2.05
  
• d5alea1 appears in SCOPe 2.07