SCOP 1.73: Domain d1vwgb_: 1vwg B:

Lineage for d1vwgb_ (1vwg B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d1vwgb_: 1vwg B: [27261]
   complexed with ace, nh2

Details for d1vwgb_

PDB Entry: 1vwg, 1.46 Å

PDB Description: streptavidin complexed with the head-to-tail disulfide-bonded peptide dimer of cyclo-ac-[chpqgppc]-nh2, ph 2.5

PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d1vwgb_:

Sequence; same for both SEQRES and ATOM records:

>d1vwgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1vwgb_:

• d1vwgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1vwgb_ appears in SCOP 1.71
  
• d1vwgb_ appears in SCOP 1.75
  
• d1vwgb_ appears in the current release, SCOPe 2.08