Lineage for d5alua1 (5alu A:2-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919509Family c.108.1.2: YihX-like [56789] (3 proteins)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF13419
  6. 2919560Protein automated matches [272539] (1 species)
    not a true protein
  7. 2919561Species Human (Homo sapiens) [TaxId:9606] [272542] (54 PDB entries)
  8. 2919565Domain d5alua1: 5alu A:2-227 [272602]
    Other proteins in same PDB: d5alua2
    automated match to d1zd3a1
    complexed with dms, hd2

Details for d5alua1

PDB Entry: 5alu (more details), 1.87 Å

PDB Description: ligand complex structure of soluble epoxide hydrolase
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d5alua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5alua1 c.108.1.2 (A:2-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

SCOPe Domain Coordinates for d5alua1:

Click to download the PDB-style file with coordinates for d5alua1.
(The format of our PDB-style files is described here.)

Timeline for d5alua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5alua2