Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.2: YihX-like [56789] (3 proteins) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF13419 |
Protein automated matches [272539] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [272542] (53 PDB entries) |
Domain d5alra1: 5alr A:2-227 [272596] Other proteins in same PDB: d5alra2 automated match to d1zd3a1 complexed with 8tm, so4 |
PDB Entry: 5alr (more details), 2.6 Å
SCOPe Domain Sequences for d5alra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5alra1 c.108.1.2 (A:2-227) automated matches {Homo sapiens [TaxId: 9606]} tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap
Timeline for d5alra1: