SCOPe 2.06: Domain d2rted_: 2rte D:

Lineage for d2rted_ (2rte D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)

8. Domain d2rted_: 2rte D: [27259]
   complexed with btn, so4

Details for d2rted_

PDB Entry: 2rte, 1.5 Å

PDB Description: streptavidin-biotin complex, ph 1.90, space group i222

PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d2rted_:

Sequence; same for both SEQRES and ATOM records:

>d2rted_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d2rted_:

• d2rted_ first appeared (with stable ids) in SCOP 1.55
  
• d2rted_ appears in SCOPe 2.05
  
• d2rted_ appears in SCOPe 2.07
  
• d2rted_ appears in the current release, SCOPe 2.08