Lineage for d5ak3a2 (5ak3 A:228-548)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869781Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 1869845Protein automated matches [271870] (1 species)
    not a true protein
  7. 1869846Species Homo sapiens [TaxId:9606] [271874] (56 PDB entries)
  8. 1869893Domain d5ak3a2: 5ak3 A:228-548 [272579]
    Other proteins in same PDB: d5ak3a1
    automated match to d3i28a2
    complexed with dms, so4, xm0

Details for d5ak3a2

PDB Entry: 5ak3 (more details), 2.28 Å

PDB Description: ligand complex structure of soluble epoxide hydrolase
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d5ak3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ak3a2 c.69.1.11 (A:228-548) automated matches {Homo sapiens [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdarn

SCOPe Domain Coordinates for d5ak3a2:

Click to download the PDB-style file with coordinates for d5ak3a2.
(The format of our PDB-style files is described here.)

Timeline for d5ak3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ak3a1