SCOP 1.73: Domain d2rtla_: 2rtl A:

Lineage for d2rtla_ (2rtl A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d2rtla_: 2rtl A: [27256]
   complexed with imi, so4

Details for d2rtla_

PDB Entry: 2rtl, 1.41 Å

PDB Description: streptavidin-2-iminobiotin-sulfate complex, ph 2.50, space group i4122

PDB Compounds: (A:) streptavidin

SCOP Domain Sequences for d2rtla_:

Sequence; same for both SEQRES and ATOM records:

>d2rtla_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtla_:

• d2rtla_ first appeared (with stable ids) in SCOP 1.55, called d2rtl__
  
• d2rtla_ was called d2rtl__ in SCOP 1.71
  
• d2rtla_ appears in SCOP 1.75
  
• d2rtla_ appears in the current release, SCOPe 2.08