Class b: All beta proteins [48724] (126 folds) |
Fold b.61: Streptavidin-like [50875] (5 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) |
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (98 PDB entries) |
Domain d2izk__: 2izk - [27255] complexed with act, gur, so4 |
PDB Entry: 2izk (more details), 1.5 Å
SCOP Domain Sequences for d2izk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izk__ b.61.1.1 (-) Streptavidin {Streptomyces avidinii} aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk vkp
Timeline for d2izk__: