SCOPe 2.05: Domain d5a1ja_: 5a1j A:

Lineage for d5a1ja_ (5a1j A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.4: TM0189-like [142789] (4 proteins)
   Part of Pfam PF01497 that include some other superfamily members

6. Protein Enterochelin uptake protein CeuE [142792] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [142793] (4 PDB entries)
   Uniprot Q0P8Q4 44-330

8. Domain d5a1ja_: 5a1j A: [272537]
   automated match to d3zkwa_
   complexed with fe, lcm

Details for d5a1ja_

PDB Entry: 5a1j, 1.6 Å

PDB Description: periplasmic binding protein ceue in complex with ferric 4-licam

PDB Compounds: (A:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d5a1ja_:

Sequence; same for both SEQRES and ATOM records:

>d5a1ja_ c.92.2.4 (A:) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]}
mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

Timeline for d5a1ja_:

• d5a1ja_ is new in SCOPe 2.05-stable
  
• d5a1ja_ is called d5a1ja1 in SCOPe 2.06
  
• d5a1ja_ appears in the current release, SCOPe 2.08, called d5a1ja1