| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
| Domain d4ypga1: 4ypg A:1-107 [272525] Other proteins in same PDB: d4ypga2, d4ypgb_, d4ypgc1, d4ypgc2, d4ypgd1, d4ypgd2, d4ypgh_, d4ypgl2 automated match to d1dn0a1 complexed with ni |
PDB Entry: 4ypg (more details), 3 Å
SCOPe Domain Sequences for d4ypga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ypga1 b.1.1.1 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsstylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygssprtfgqgtkvei
Timeline for d4ypga1: