Lineage for d4zg5d_ (4zg5 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919320Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2919321Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2919337Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2919338Protein automated matches [190619] (7 species)
    not a true protein
  7. 2919344Species Brucella abortus [TaxId:430066] [257661] (1 PDB entry)
  8. 2919347Domain d4zg5d_: 4zg5 D: [272523]
    automated match to d1j9la_
    complexed with mg

Details for d4zg5d_

PDB Entry: 4zg5 (more details), 1.9 Å

PDB Description: structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus
PDB Compounds: (D:) 5'-nucleotidase sure

SCOPe Domain Sequences for d4zg5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zg5d_ c.106.1.0 (D:) automated matches {Brucella abortus [TaxId: 430066]}
mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
hkvraelgaalg

SCOPe Domain Coordinates for d4zg5d_:

Click to download the PDB-style file with coordinates for d4zg5d_.
(The format of our PDB-style files is described here.)

Timeline for d4zg5d_: