| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
Superfamily c.106.1: SurE-like [64167] (2 families) ![]() some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
| Family c.106.1.0: automated matches [191430] (1 protein) not a true family |
| Protein automated matches [190619] (7 species) not a true protein |
| Species Brucella abortus [TaxId:430066] [257661] (1 PDB entry) |
| Domain d4zg5d_: 4zg5 D: [272523] automated match to d1j9la_ complexed with mg |
PDB Entry: 4zg5 (more details), 1.9 Å
SCOPe Domain Sequences for d4zg5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zg5d_ c.106.1.0 (D:) automated matches {Brucella abortus [TaxId: 430066]}
mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
hkvraelgaalg
Timeline for d4zg5d_: