SCOPe 2.08: Domain d4zeya1: 4zey A:4-86

Lineage for d4zeya1 (4zey A:4-86)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.16: MIT domain-like [140361] (1 family)

5. Family a.7.16.1: MIT domain [140362] (2 proteins)
   this is a repeat family; one repeat unit is 2crb A:8-90 found in domain

6. Protein automated matches [272516] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [272517] (1 PDB entry)

8. Domain d4zeya1: 4zey A:4-86 [272518]
   Other proteins in same PDB: d4zeya2
   automated match to d2crba1
   complexed with so4

Details for d4zeya1

PDB Entry: 4zey, 1.5 Å

PDB Description: crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution

PDB Compounds: (A:) Nuclear receptor-binding factor 2

SCOPe Domain Sequences for d4zeya1:

Sequence; same for both SEQRES and ATOM records:

>d4zeya1 a.7.16.1 (A:4-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
megplnlahqqsrradrllaagkyeeaischkkaaaylseamkltqseqahlslelqrds
hmkqllliqerwkraqreerlka

Timeline for d4zeya1:

• d4zeya1 first appeared in SCOPe 2.05, called d4zeya_
  
• d4zeya1 appears in SCOPe 2.07